Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,519
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,223
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 8,203
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,109
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,091
  6. Avatar for Deleted group 16. Deleted group pts. 7,509
  7. Avatar for test_group1 17. test_group1 1 pt. 0
  1. Avatar for smcclosk 121. smcclosk Lv 1 1 pt. 8,088
  2. Avatar for lamoille 122. lamoille Lv 1 1 pt. 8,039
  3. Avatar for justjustin 123. justjustin Lv 1 1 pt. 8,038
  4. Avatar for a791412276 124. a791412276 Lv 1 1 pt. 8,025
  5. Avatar for alwen 125. alwen Lv 1 1 pt. 8,006
  6. Avatar for momadoc 126. momadoc Lv 1 1 pt. 7,982
  7. Avatar for parsnip 127. parsnip Lv 1 1 pt. 7,927
  8. Avatar for susithran 128. susithran Lv 1 1 pt. 7,881
  9. Avatar for Deadpool31 129. Deadpool31 Lv 1 1 pt. 7,809
  10. Avatar for Erica_W 130. Erica_W Lv 1 1 pt. 7,509

Comments