Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Contenders 100 pts. 8,848
  2. Avatar for Go Science 2. Go Science 73 pts. 8,848
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 8,848
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 8,844
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 8,841
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 8,818
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 8,816
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 8,786
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 8,757
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,754

  1. Avatar for frood66 51. frood66 Lv 1 11 pts. 8,745
  2. Avatar for SaraL 52. SaraL Lv 1 10 pts. 8,742
  3. Avatar for weitzen 53. weitzen Lv 1 10 pts. 8,742
  4. Avatar for andrewxc 54. andrewxc Lv 1 9 pts. 8,740
  5. Avatar for Glen B 55. Glen B Lv 1 9 pts. 8,739
  6. Avatar for fpc 56. fpc Lv 1 8 pts. 8,737
  7. Avatar for isaksson 57. isaksson Lv 1 8 pts. 8,730
  8. Avatar for stomjoh 58. stomjoh Lv 1 7 pts. 8,729
  9. Avatar for ViJay7019 59. ViJay7019 Lv 1 7 pts. 8,726
  10. Avatar for lupussapien 60. lupussapien Lv 1 6 pts. 8,722

Comments