Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,848
  2. Avatar for Go Science 2. Go Science 73 pts. 8,848
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 8,848
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 8,844
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 8,841
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 8,818
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 8,816
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 8,786
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 8,757
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,754
  1. Avatar for Vinara 71. Vinara Lv 1 3 pts. 8,661
  2. Avatar for manu8170 72. manu8170 Lv 1 3 pts. 8,658
  3. Avatar for goldfish80 73. goldfish80 Lv 1 3 pts. 8,653
  4. Avatar for dizzywings 74. dizzywings Lv 1 3 pts. 8,652
  5. Avatar for dbuske 75. dbuske Lv 1 3 pts. 8,650
  6. Avatar for froggs554 76. froggs554 Lv 1 2 pts. 8,647
  7. Avatar for jobo0502 77. jobo0502 Lv 1 2 pts. 8,642
  8. Avatar for leehaggis 78. leehaggis Lv 1 2 pts. 8,639
  9. Avatar for anthion 79. anthion Lv 1 2 pts. 8,636
  10. Avatar for diamonddays 80. diamonddays Lv 1 2 pts. 8,634

Comments