Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Deleted group 20. Deleted group pts. 5,517

  1. Avatar for fpc 111. fpc Lv 1 1 pt. 8,424
  2. Avatar for MicElephant 112. MicElephant Lv 1 1 pt. 8,408
  3. Avatar for Vincera 113. Vincera Lv 1 1 pt. 8,406
  4. Avatar for Superphosphate 114. Superphosphate Lv 1 1 pt. 8,386
  5. Avatar for Deleted player 115. Deleted player 1 pt. 8,363
  6. Avatar for ZAxel91 116. ZAxel91 Lv 1 1 pt. 8,355
  7. Avatar for Arne Heessels 117. Arne Heessels Lv 1 1 pt. 8,334
  8. Avatar for ProHarTius 118. ProHarTius Lv 1 1 pt. 8,312
  9. Avatar for Hollinas 119. Hollinas Lv 1 1 pt. 8,309
  10. Avatar for rinze 120. rinze Lv 1 1 pt. 8,286

Comments