Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091
  1. Avatar for fpc 111. fpc Lv 1 1 pt. 8,424
  2. Avatar for MicElephant 112. MicElephant Lv 1 1 pt. 8,408
  3. Avatar for Vincera 113. Vincera Lv 1 1 pt. 8,406
  4. Avatar for Superphosphate 114. Superphosphate Lv 1 1 pt. 8,386
  5. Avatar for Deleted player 115. Deleted player 1 pt. 8,363
  6. Avatar for ZAxel91 116. ZAxel91 Lv 1 1 pt. 8,355
  7. Avatar for Arne Heessels 117. Arne Heessels Lv 1 1 pt. 8,334
  8. Avatar for ProHarTius 118. ProHarTius Lv 1 1 pt. 8,312
  9. Avatar for Hollinas 119. Hollinas Lv 1 1 pt. 8,309
  10. Avatar for rinze 120. rinze Lv 1 1 pt. 8,286

Comments