Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Topics in Bioscience and Biotech 19. Topics in Bioscience and Biotech 1 pt. 7,215
  10. Avatar for Deleted group 20. Deleted group pts. 5,517
  1. Avatar for DScott 131. DScott Lv 1 1 pt. 7,493
  2. Avatar for 64SciOne 132. 64SciOne Lv 1 1 pt. 7,442
  3. Avatar for Radeodem8 133. Radeodem8 Lv 1 1 pt. 7,341
  4. Avatar for pandapharmd 134. pandapharmd Lv 1 1 pt. 7,254
  5. Avatar for coreyinthehouse 135. coreyinthehouse Lv 1 1 pt. 7,215
  6. Avatar for Nietuzinkowy123 136. Nietuzinkowy123 Lv 1 1 pt. 7,136
  7. Avatar for a791412276 137. a791412276 Lv 1 1 pt. 6,999
  8. Avatar for cnhrcolemam 138. cnhrcolemam Lv 1 1 pt. 6,878
  9. Avatar for groudit 139. groudit Lv 1 1 pt. 6,876
  10. Avatar for heyubob 140. heyubob Lv 1 1 pt. 6,824

Comments