Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091
  1. Avatar for DScott 131. DScott Lv 1 1 pt. 7,493
  2. Avatar for 64SciOne 132. 64SciOne Lv 1 1 pt. 7,442
  3. Avatar for Radeodem8 133. Radeodem8 Lv 1 1 pt. 7,341
  4. Avatar for pandapharmd 134. pandapharmd Lv 1 1 pt. 7,254
  5. Avatar for coreyinthehouse 135. coreyinthehouse Lv 1 1 pt. 7,215
  6. Avatar for Nietuzinkowy123 136. Nietuzinkowy123 Lv 1 1 pt. 7,136
  7. Avatar for a791412276 137. a791412276 Lv 1 1 pt. 6,999
  8. Avatar for cnhrcolemam 138. cnhrcolemam Lv 1 1 pt. 6,878
  9. Avatar for groudit 139. groudit Lv 1 1 pt. 6,876
  10. Avatar for heyubob 140. heyubob Lv 1 1 pt. 6,824

Comments