Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Topics in Bioscience and Biotech 19. Topics in Bioscience and Biotech 1 pt. 7,215
  10. Avatar for Deleted group 20. Deleted group pts. 5,517
  1. Avatar for Scopper 61. Scopper Lv 1 9 pts. 8,953
  2. Avatar for froggs554 62. froggs554 Lv 1 8 pts. 8,950
  3. Avatar for pvc78 63. pvc78 Lv 1 8 pts. 8,949
  4. Avatar for drumpeter18yrs9yrs 64. drumpeter18yrs9yrs Lv 1 8 pts. 8,946
  5. Avatar for georg137 65. georg137 Lv 1 7 pts. 8,940
  6. Avatar for Glen B 66. Glen B Lv 1 7 pts. 8,934
  7. Avatar for stomjoh 67. stomjoh Lv 1 6 pts. 8,931
  8. Avatar for diamonddays 68. diamonddays Lv 1 6 pts. 8,928
  9. Avatar for alcor29 69. alcor29 Lv 1 6 pts. 8,919
  10. Avatar for Mike Cassidy 70. Mike Cassidy Lv 1 5 pts. 8,904

Comments