Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091
  1. Avatar for Scopper 61. Scopper Lv 1 9 pts. 8,953
  2. Avatar for froggs554 62. froggs554 Lv 1 8 pts. 8,950
  3. Avatar for pvc78 63. pvc78 Lv 1 8 pts. 8,949
  4. Avatar for drumpeter18yrs9yrs 64. drumpeter18yrs9yrs Lv 1 8 pts. 8,946
  5. Avatar for georg137 65. georg137 Lv 1 7 pts. 8,940
  6. Avatar for Glen B 66. Glen B Lv 1 7 pts. 8,934
  7. Avatar for stomjoh 67. stomjoh Lv 1 6 pts. 8,931
  8. Avatar for diamonddays 68. diamonddays Lv 1 6 pts. 8,928
  9. Avatar for alcor29 69. alcor29 Lv 1 6 pts. 8,919
  10. Avatar for Mike Cassidy 70. Mike Cassidy Lv 1 5 pts. 8,904

Comments