Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Topics in Bioscience and Biotech 19. Topics in Bioscience and Biotech 1 pt. 7,215
  10. Avatar for Deleted group 20. Deleted group pts. 5,517
  1. Avatar for drjr 81. drjr Lv 1 3 pts. 8,816
  2. Avatar for Merf 82. Merf Lv 1 3 pts. 8,814
  3. Avatar for bcre8tvv 83. bcre8tvv Lv 1 3 pts. 8,807
  4. Avatar for FishKAA 84. FishKAA Lv 1 3 pts. 8,798
  5. Avatar for benrh 85. benrh Lv 1 2 pts. 8,790
  6. Avatar for jausmh 86. jausmh Lv 1 2 pts. 8,768
  7. Avatar for weitzen 87. weitzen Lv 1 2 pts. 8,764
  8. Avatar for fryguy 88. fryguy Lv 1 2 pts. 8,761
  9. Avatar for Mr_Jolty 89. Mr_Jolty Lv 1 2 pts. 8,752
  10. Avatar for ralan-nsk 90. ralan-nsk Lv 1 2 pts. 8,750

Comments