Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091

  1. Avatar for drjr 81. drjr Lv 1 3 pts. 8,816
  2. Avatar for Merf 82. Merf Lv 1 3 pts. 8,814
  3. Avatar for bcre8tvv 83. bcre8tvv Lv 1 3 pts. 8,807
  4. Avatar for FishKAA 84. FishKAA Lv 1 3 pts. 8,798
  5. Avatar for benrh 85. benrh Lv 1 2 pts. 8,790
  6. Avatar for jausmh 86. jausmh Lv 1 2 pts. 8,768
  7. Avatar for weitzen 87. weitzen Lv 1 2 pts. 8,764
  8. Avatar for fryguy 88. fryguy Lv 1 2 pts. 8,761
  9. Avatar for Mr_Jolty 89. Mr_Jolty Lv 1 2 pts. 8,752
  10. Avatar for ralan-nsk 90. ralan-nsk Lv 1 2 pts. 8,750

Comments