Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 0
  1. Avatar for canderson712 121. canderson712 Lv 1 1 pt. 8,247
  2. Avatar for douira 122. douira Lv 1 1 pt. 8,137
  3. Avatar for cherry39 123. cherry39 Lv 1 1 pt. 8,053
  4. Avatar for Erica_W 124. Erica_W Lv 1 1 pt. 7,970
  5. Avatar for lamoille 125. lamoille Lv 1 1 pt. 7,927
  6. Avatar for ZyForce 126. ZyForce Lv 1 1 pt. 7,904
  7. Avatar for FoldinCaulfield 127. FoldinCaulfield Lv 1 1 pt. 7,887
  8. Avatar for mcatneuro1 128. mcatneuro1 Lv 1 1 pt. 7,790
  9. Avatar for dbuske 129. dbuske Lv 1 1 pt. 7,749
  10. Avatar for skracked 130. skracked Lv 1 1 pt. 7,585

Comments