Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091

  1. Avatar for canderson712 121. canderson712 Lv 1 1 pt. 8,247
  2. Avatar for douira 122. douira Lv 1 1 pt. 8,137
  3. Avatar for cherry39 123. cherry39 Lv 1 1 pt. 8,053
  4. Avatar for Erica_W 124. Erica_W Lv 1 1 pt. 7,970
  5. Avatar for lamoille 125. lamoille Lv 1 1 pt. 7,927
  6. Avatar for ZyForce 126. ZyForce Lv 1 1 pt. 7,904
  7. Avatar for FoldinCaulfield 127. FoldinCaulfield Lv 1 1 pt. 7,887
  8. Avatar for mcatneuro1 128. mcatneuro1 Lv 1 1 pt. 7,790
  9. Avatar for dbuske 129. dbuske Lv 1 1 pt. 7,749
  10. Avatar for skracked 130. skracked Lv 1 1 pt. 7,585

Comments