Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091
  1. Avatar for smilingone 21. smilingone Lv 1 50 pts. 9,150
  2. Avatar for tokens 22. tokens Lv 1 48 pts. 9,145
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 47 pts. 9,141
  4. Avatar for O Seki To 24. O Seki To Lv 1 45 pts. 9,128
  5. Avatar for LociOiling 25. LociOiling Lv 1 43 pts. 9,127
  6. Avatar for spvincent 26. spvincent Lv 1 41 pts. 9,124
  7. Avatar for isaksson 27. isaksson Lv 1 40 pts. 9,123
  8. Avatar for SWR_DMaster 28. SWR_DMaster Lv 1 38 pts. 9,123
  9. Avatar for mimi 29. mimi Lv 1 37 pts. 9,123
  10. Avatar for gmn 30. gmn Lv 1 35 pts. 9,120

Comments