Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091
  1. Avatar for pauldunn 31. pauldunn Lv 1 34 pts. 9,120
  2. Avatar for manu8170 32. manu8170 Lv 1 33 pts. 9,119
  3. Avatar for kabubi 33. kabubi Lv 1 31 pts. 9,115
  4. Avatar for Vinara 34. Vinara Lv 1 30 pts. 9,112
  5. Avatar for bertro 35. bertro Lv 1 29 pts. 9,107
  6. Avatar for johnmitch 36. johnmitch Lv 1 28 pts. 9,100
  7. Avatar for crpainter 37. crpainter Lv 1 27 pts. 9,092
  8. Avatar for Hiro Protagonist 38. Hiro Protagonist Lv 1 26 pts. 9,091
  9. Avatar for nicobul 39. nicobul Lv 1 24 pts. 9,091
  10. Avatar for christioanchauvin 40. christioanchauvin Lv 1 23 pts. 9,079

Comments