Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209
  1. Avatar for canderson712 131. canderson712 Lv 1 1 pt. 8,516
  2. Avatar for leannerikicheever 132. leannerikicheever Lv 1 1 pt. 8,516
  3. Avatar for Nietuzinkowy123 133. Nietuzinkowy123 Lv 1 1 pt. 8,479
  4. Avatar for doctaven 134. doctaven Lv 1 1 pt. 8,469
  5. Avatar for yashoda 135. yashoda Lv 1 1 pt. 8,468
  6. Avatar for toshishi 136. toshishi Lv 1 1 pt. 8,433
  7. Avatar for BIO257C-blozano 137. BIO257C-blozano Lv 1 1 pt. 8,425
  8. Avatar for jflat06 138. jflat06 Lv 1 1 pt. 8,328
  9. Avatar for jbmkfm125 139. jbmkfm125 Lv 1 1 pt. 8,096
  10. Avatar for 01010011111 140. 01010011111 Lv 1 1 pt. 8,042

Comments