Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209
  1. Avatar for Flagg65a 141. Flagg65a Lv 1 1 pt. 7,891
  2. Avatar for Uttkarsh 142. Uttkarsh Lv 1 1 pt. 7,868
  3. Avatar for eromana 143. eromana Lv 1 1 pt. 7,868
  4. Avatar for Susume 144. Susume Lv 1 1 pt. 7,868
  5. Avatar for Turquoise 145. Turquoise Lv 1 1 pt. 7,868
  6. Avatar for jeff101 146. jeff101 Lv 1 1 pt. 7,868
  7. Avatar for Hollinas 147. Hollinas Lv 1 1 pt. 7,868
  8. Avatar for a791412276 148. a791412276 Lv 1 1 pt. 7,868
  9. Avatar for julianam 149. julianam Lv 1 1 pt. 7,868
  10. Avatar for Scopper 150. Scopper Lv 1 1 pt. 7,868

Comments