Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209
  1. Avatar for harvardman 101. harvardman Lv 1 1 pt. 8,869
  2. Avatar for Arne Heessels 102. Arne Heessels Lv 1 1 pt. 8,866
  3. Avatar for martinf 103. martinf Lv 1 1 pt. 8,864
  4. Avatar for benrh 104. benrh Lv 1 1 pt. 8,861
  5. Avatar for emdee314 105. emdee314 Lv 1 1 pt. 8,858
  6. Avatar for Mr_Jolty 106. Mr_Jolty Lv 1 1 pt. 8,844
  7. Avatar for jamiexq 107. jamiexq Lv 1 1 pt. 8,841
  8. Avatar for spritz1992 108. spritz1992 Lv 1 1 pt. 8,825
  9. Avatar for MicheleVerret 109. MicheleVerret Lv 1 1 pt. 8,822
  10. Avatar for poiuyqwert 110. poiuyqwert Lv 1 1 pt. 8,818

Comments