Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 72 pts. 8,981
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 70 pts. 8,972
  3. Avatar for actiasluna 13. actiasluna Lv 1 67 pts. 8,972
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 65 pts. 8,966
  5. Avatar for johnmitch 15. johnmitch Lv 1 63 pts. 8,966
  6. Avatar for LociOiling 16. LociOiling Lv 1 60 pts. 8,964
  7. Avatar for eusair 17. eusair Lv 1 58 pts. 8,962
  8. Avatar for Hiro Protagonist 18. Hiro Protagonist Lv 1 56 pts. 8,962
  9. Avatar for phi16 19. phi16 Lv 1 54 pts. 8,952
  10. Avatar for markm457 20. markm457 Lv 1 52 pts. 8,950

Comments