Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894
  1. Avatar for fpc 21. fpc Lv 1 50 pts. 8,950
  2. Avatar for guineapig 22. guineapig Lv 1 49 pts. 8,949
  3. Avatar for mimi 23. mimi Lv 1 47 pts. 8,949
  4. Avatar for Galaxie 24. Galaxie Lv 1 45 pts. 8,948
  5. Avatar for georg137 25. georg137 Lv 1 43 pts. 8,945
  6. Avatar for joremen 26. joremen Lv 1 42 pts. 8,944
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 40 pts. 8,943
  8. Avatar for Deleted player 28. Deleted player pts. 8,942
  9. Avatar for Blipperman 29. Blipperman Lv 1 37 pts. 8,942
  10. Avatar for kabubi 30. kabubi Lv 1 36 pts. 8,937

Comments