Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894
  1. Avatar for ViJay7019 41. ViJay7019 Lv 1 23 pts. 8,899
  2. Avatar for toshiue 42. toshiue Lv 1 22 pts. 8,895
  3. Avatar for frood66 43. frood66 Lv 1 21 pts. 8,894
  4. Avatar for Merf 44. Merf Lv 1 20 pts. 8,892
  5. Avatar for Jim Fraser 45. Jim Fraser Lv 1 19 pts. 8,889
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 18 pts. 8,886
  7. Avatar for tomespen 47. tomespen Lv 1 17 pts. 8,885
  8. Avatar for pvc78 48. pvc78 Lv 1 17 pts. 8,884
  9. Avatar for katling 49. katling Lv 1 16 pts. 8,881
  10. Avatar for caglar 50. caglar Lv 1 15 pts. 8,877

Comments