Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for ppp6 91. ppp6 Lv 1 2 pts. 8,597
  2. Avatar for abledbody 92. abledbody Lv 1 2 pts. 8,596
  3. Avatar for boondog 93. boondog Lv 1 2 pts. 8,589
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 2 pts. 8,577
  5. Avatar for benrh 95. benrh Lv 1 2 pts. 8,562
  6. Avatar for Hiro Protagonist 96. Hiro Protagonist Lv 1 1 pt. 8,550
  7. Avatar for Astray 97. Astray Lv 1 1 pt. 8,548
  8. Avatar for momadoc 98. momadoc Lv 1 1 pt. 8,475
  9. Avatar for YGK 99. YGK Lv 1 1 pt. 8,473
  10. Avatar for FractalCuber 100. FractalCuber Lv 1 1 pt. 8,460

Comments