Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for ViJay7019 101. ViJay7019 Lv 1 1 pt. 8,448
  2. Avatar for Vincenzo Brancaccio 102. Vincenzo Brancaccio Lv 1 1 pt. 8,443
  3. Avatar for Flagg65a 103. Flagg65a Lv 1 1 pt. 8,356
  4. Avatar for rabamino12358 104. rabamino12358 Lv 1 1 pt. 8,352
  5. Avatar for dbuske 105. dbuske Lv 1 1 pt. 8,326
  6. Avatar for mitarcher 106. mitarcher Lv 1 1 pt. 8,306
  7. Avatar for Alistair69 107. Alistair69 Lv 1 1 pt. 8,294
  8. Avatar for Deleted player 108. Deleted player pts. 8,236
  9. Avatar for ThomasWester 109. ThomasWester Lv 1 1 pt. 8,165
  10. Avatar for Bautho 110. Bautho Lv 1 1 pt. 8,114

Comments