Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for NotJim99 111. NotJim99 Lv 1 1 pt. 8,062
  2. Avatar for Erica_W 112. Erica_W Lv 1 1 pt. 8,002
  3. Avatar for ExecrabLe 113. ExecrabLe Lv 1 1 pt. 7,908
  4. Avatar for Vincera 114. Vincera Lv 1 1 pt. 7,891
  5. Avatar for Jspirit 115. Jspirit Lv 1 1 pt. 7,876
  6. Avatar for FoldinCaulfield 116. FoldinCaulfield Lv 1 1 pt. 7,678
  7. Avatar for ResetVirus 117. ResetVirus Lv 1 1 pt. 7,629
  8. Avatar for chemtox 118. chemtox Lv 1 1 pt. 7,585
  9. Avatar for rinze 119. rinze Lv 1 1 pt. 7,546
  10. Avatar for lamoille 120. lamoille Lv 1 1 pt. 7,535

Comments