Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for Jim Fraser 121. Jim Fraser Lv 1 1 pt. 7,531
  2. Avatar for fujioyama 122. fujioyama Lv 1 1 pt. 7,523
  3. Avatar for Mr_Jolty 123. Mr_Jolty Lv 1 1 pt. 7,512
  4. Avatar for elvis19965 124. elvis19965 Lv 1 1 pt. 7,472
  5. Avatar for becirrius 125. becirrius Lv 1 1 pt. 7,388
  6. Avatar for MadCat08 126. MadCat08 Lv 1 1 pt. 7,285
  7. Avatar for DScott 127. DScott Lv 1 1 pt. 7,273
  8. Avatar for Pibeagles 128. Pibeagles Lv 1 1 pt. 7,035
  9. Avatar for Nisgan 129. Nisgan Lv 1 1 pt. 6,958
  10. Avatar for 8bitpineapple 130. 8bitpineapple Lv 1 1 pt. 6,944

Comments