Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for rishav mitra 131. rishav mitra Lv 1 1 pt. 6,901
  2. Avatar for biziclop 132. biziclop Lv 1 1 pt. 6,795
  3. Avatar for pandapharmd 133. pandapharmd Lv 1 1 pt. 6,713
  4. Avatar for SNix 134. SNix Lv 1 1 pt. 6,673
  5. Avatar for yoyo5143 135. yoyo5143 Lv 1 1 pt. 6,454
  6. Avatar for niftyfingers 136. niftyfingers Lv 1 1 pt. 6,400
  7. Avatar for Mydogisa Toelicker 137. Mydogisa Toelicker Lv 1 1 pt. 6,361
  8. Avatar for Enikitten 138. Enikitten Lv 1 1 pt. 6,161
  9. Avatar for imclinicallydepressed 139. imclinicallydepressed Lv 1 1 pt. 6,019
  10. Avatar for Jaroel 140. Jaroel Lv 1 1 pt. 5,855

Comments