Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for BogdanW3 141. BogdanW3 Lv 1 1 pt. 5,747
  2. Avatar for Giantbluefish 142. Giantbluefish Lv 1 1 pt. 5,664
  3. Avatar for skymward 143. skymward Lv 1 1 pt. 5,647
  4. Avatar for peytonnielsen 144. peytonnielsen Lv 1 1 pt. 5,193
  5. Avatar for Hiroki Kyoto 145. Hiroki Kyoto Lv 1 1 pt. 5,101
  6. Avatar for Blitzghost 146. Blitzghost Lv 1 1 pt. 5,023
  7. Avatar for Operon Lac 147. Operon Lac Lv 1 1 pt. 4,829
  8. Avatar for Husain.Sarah 148. Husain.Sarah Lv 1 1 pt. 4,713
  9. Avatar for arlettelh97 149. arlettelh97 Lv 1 1 pt. 4,659
  10. Avatar for wozzarelli 150. wozzarelli Lv 1 1 pt. 4,260

Comments