Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for Doggomodo 151. Doggomodo Lv 1 1 pt. 2,061
  2. Avatar for fishercat 152. fishercat Lv 1 1 pt. 0
  3. Avatar for jeff101 153. jeff101 Lv 1 1 pt. 0
  4. Avatar for Neil9 154. Neil9 Lv 1 1 pt. 0
  5. Avatar for CaptainDerp 155. CaptainDerp Lv 1 1 pt. 0
  6. Avatar for with_science 156. with_science Lv 1 1 pt. 0
  7. Avatar for Hollinas 157. Hollinas Lv 1 1 pt. 0
  8. Avatar for eromana 158. eromana Lv 1 1 pt. 0

Comments