Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for johnmitch 11. johnmitch Lv 1 72 pts. 9,677
  2. Avatar for bertro 12. bertro Lv 1 70 pts. 9,663
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 68 pts. 9,629
  4. Avatar for Galaxie 14. Galaxie Lv 1 65 pts. 9,597
  5. Avatar for mimi 15. mimi Lv 1 63 pts. 9,596
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 61 pts. 9,585
  7. Avatar for Enzyme 17. Enzyme Lv 1 59 pts. 9,580
  8. Avatar for LociOiling 18. LociOiling Lv 1 57 pts. 9,577
  9. Avatar for gitwut 19. gitwut Lv 1 55 pts. 9,576
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 53 pts. 9,568

Comments