Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for spvincent 21. spvincent Lv 1 51 pts. 9,564
  2. Avatar for Timo van der Laan 22. Timo van der Laan Lv 1 49 pts. 9,556
  3. Avatar for anthion 23. anthion Lv 1 48 pts. 9,553
  4. Avatar for Blipperman 24. Blipperman Lv 1 46 pts. 9,548
  5. Avatar for isaksson 25. isaksson Lv 1 44 pts. 9,517
  6. Avatar for smilingone 26. smilingone Lv 1 43 pts. 9,509
  7. Avatar for kabubi 27. kabubi Lv 1 41 pts. 9,506
  8. Avatar for YeshuaLives 28. YeshuaLives Lv 1 39 pts. 9,504
  9. Avatar for phi16 29. phi16 Lv 1 38 pts. 9,473
  10. Avatar for pauldunn 30. pauldunn Lv 1 37 pts. 9,461

Comments