Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for dssb 61. dssb Lv 1 10 pts. 9,103
  2. Avatar for drumpeter18yrs9yrs 62. drumpeter18yrs9yrs Lv 1 9 pts. 9,092
  3. Avatar for diamonddays 63. diamonddays Lv 1 9 pts. 9,081
  4. Avatar for heather-1 64. heather-1 Lv 1 8 pts. 9,074
  5. Avatar for dizzywings 65. dizzywings Lv 1 8 pts. 9,000
  6. Avatar for molleke 66. molleke Lv 1 7 pts. 8,992
  7. Avatar for stomjoh 67. stomjoh Lv 1 7 pts. 8,981
  8. Avatar for TastyMunchies 68. TastyMunchies Lv 1 7 pts. 8,969
  9. Avatar for Superphosphate 69. Superphosphate Lv 1 6 pts. 8,943
  10. Avatar for machinelves 70. machinelves Lv 1 6 pts. 8,923

Comments