Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for ralan-nsk 71. ralan-nsk Lv 1 6 pts. 8,914
  2. Avatar for georg137 72. georg137 Lv 1 5 pts. 8,912
  3. Avatar for harvardman 73. harvardman Lv 1 5 pts. 8,890
  4. Avatar for Merf 74. Merf Lv 1 5 pts. 8,887
  5. Avatar for Deleted player 75. Deleted player pts. 8,884
  6. Avatar for Deleted player 76. Deleted player pts. 8,862
  7. Avatar for andrewxc 77. andrewxc Lv 1 4 pts. 8,857
  8. Avatar for deLaCeiba 78. deLaCeiba Lv 1 4 pts. 8,856
  9. Avatar for ZAxel91 79. ZAxel91 Lv 1 4 pts. 8,855
  10. Avatar for froggs554 80. froggs554 Lv 1 4 pts. 8,854

Comments