Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for pfirth 101. pfirth Lv 1 2 pts. 8,603
  2. Avatar for froggs554 102. froggs554 Lv 1 2 pts. 8,583
  3. Avatar for wuhongzei 103. wuhongzei Lv 1 2 pts. 8,536
  4. Avatar for Bautho 104. Bautho Lv 1 2 pts. 8,522
  5. Avatar for Pibeagles 105. Pibeagles Lv 1 2 pts. 8,447
  6. Avatar for trentis1 106. trentis1 Lv 1 1 pt. 8,435
  7. Avatar for ciberhunter 107. ciberhunter Lv 1 1 pt. 8,418
  8. Avatar for molleke 108. molleke Lv 1 1 pt. 8,412
  9. Avatar for Erica_W 109. Erica_W Lv 1 1 pt. 8,385
  10. Avatar for momadoc 110. momadoc Lv 1 1 pt. 8,380

Comments