Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022
  1. Avatar for pfirth 101. pfirth Lv 1 2 pts. 8,603
  2. Avatar for froggs554 102. froggs554 Lv 1 2 pts. 8,583
  3. Avatar for wuhongzei 103. wuhongzei Lv 1 2 pts. 8,536
  4. Avatar for Bautho 104. Bautho Lv 1 2 pts. 8,522
  5. Avatar for Pibeagles 105. Pibeagles Lv 1 2 pts. 8,447
  6. Avatar for trentis1 106. trentis1 Lv 1 1 pt. 8,435
  7. Avatar for ciberhunter 107. ciberhunter Lv 1 1 pt. 8,418
  8. Avatar for molleke 108. molleke Lv 1 1 pt. 8,412
  9. Avatar for Erica_W 109. Erica_W Lv 1 1 pt. 8,385
  10. Avatar for momadoc 110. momadoc Lv 1 1 pt. 8,380

Comments