Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for fujioyama 121. fujioyama Lv 1 1 pt. 7,968
  2. Avatar for Jspirit 122. Jspirit Lv 1 1 pt. 7,941
  3. Avatar for parsnip 123. parsnip Lv 1 1 pt. 7,931
  4. Avatar for Michele_H 124. Michele_H Lv 1 1 pt. 7,820
  5. Avatar for BuzzDee 125. BuzzDee Lv 1 1 pt. 7,803
  6. Avatar for NotJim99 126. NotJim99 Lv 1 1 pt. 7,795
  7. Avatar for MadCat08 127. MadCat08 Lv 1 1 pt. 7,745
  8. Avatar for tela 128. tela Lv 1 1 pt. 7,710
  9. Avatar for Caleb_Y 129. Caleb_Y Lv 1 1 pt. 7,677
  10. Avatar for DScott 130. DScott Lv 1 1 pt. 7,651

Comments