Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for Meghan_SegretiE 151. Meghan_SegretiE Lv 1 1 pt. 5,915
  2. Avatar for pisome 152. pisome Lv 1 1 pt. 5,852
  3. Avatar for Adnan_K 153. Adnan_K Lv 1 1 pt. 5,773
  4. Avatar for Husain.Sarah 154. Husain.Sarah Lv 1 1 pt. 5,759
  5. Avatar for parthpatel09 155. parthpatel09 Lv 1 1 pt. 5,704
  6. Avatar for Radek007 156. Radek007 Lv 1 1 pt. 5,595
  7. Avatar for Danya13 157. Danya13 Lv 1 1 pt. 5,366
  8. Avatar for robkleffner 158. robkleffner Lv 1 1 pt. 5,020
  9. Avatar for blank314 159. blank314 Lv 1 1 pt. 4,834
  10. Avatar for Eggriculture11 160. Eggriculture11 Lv 1 1 pt. 3,031

Comments