Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022

  1. Avatar for Meghan_SegretiE 151. Meghan_SegretiE Lv 1 1 pt. 5,915
  2. Avatar for pisome 152. pisome Lv 1 1 pt. 5,852
  3. Avatar for Adnan_K 153. Adnan_K Lv 1 1 pt. 5,773
  4. Avatar for Husain.Sarah 154. Husain.Sarah Lv 1 1 pt. 5,759
  5. Avatar for parthpatel09 155. parthpatel09 Lv 1 1 pt. 5,704
  6. Avatar for Radek007 156. Radek007 Lv 1 1 pt. 5,595
  7. Avatar for Danya13 157. Danya13 Lv 1 1 pt. 5,366
  8. Avatar for robkleffner 158. robkleffner Lv 1 1 pt. 5,020
  9. Avatar for blank314 159. blank314 Lv 1 1 pt. 4,834
  10. Avatar for Eggriculture11 160. Eggriculture11 Lv 1 1 pt. 3,031

Comments