Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for gmn 11. gmn Lv 1 75 pts. 9,497
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 73 pts. 9,487
  3. Avatar for gitwut 13. gitwut Lv 1 70 pts. 9,459
  4. Avatar for frood66 14. frood66 Lv 1 68 pts. 9,448
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 66 pts. 9,447
  6. Avatar for eusair 16. eusair Lv 1 64 pts. 9,442
  7. Avatar for Enzyme 17. Enzyme Lv 1 62 pts. 9,436
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 60 pts. 9,433
  9. Avatar for LociOiling 19. LociOiling Lv 1 58 pts. 9,417
  10. Avatar for Wilm 20. Wilm Lv 1 57 pts. 9,410

Comments