Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 55 pts. 9,400
  2. Avatar for jeff101 22. jeff101 Lv 1 53 pts. 9,384
  3. Avatar for caglar 23. caglar Lv 1 51 pts. 9,373
  4. Avatar for mimi 24. mimi Lv 1 50 pts. 9,368
  5. Avatar for reefyrob 25. reefyrob Lv 1 48 pts. 9,367
  6. Avatar for grogar7 26. grogar7 Lv 1 47 pts. 9,364
  7. Avatar for anthion 27. anthion Lv 1 45 pts. 9,361
  8. Avatar for spvincent 28. spvincent Lv 1 44 pts. 9,356
  9. Avatar for ZeroLeak7 29. ZeroLeak7 Lv 1 42 pts. 9,348
  10. Avatar for Bletchley Park 30. Bletchley Park Lv 1 41 pts. 9,304

Comments