Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022

  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 55 pts. 9,400
  2. Avatar for jeff101 22. jeff101 Lv 1 53 pts. 9,384
  3. Avatar for caglar 23. caglar Lv 1 51 pts. 9,373
  4. Avatar for mimi 24. mimi Lv 1 50 pts. 9,368
  5. Avatar for reefyrob 25. reefyrob Lv 1 48 pts. 9,367
  6. Avatar for grogar7 26. grogar7 Lv 1 47 pts. 9,364
  7. Avatar for anthion 27. anthion Lv 1 45 pts. 9,361
  8. Avatar for spvincent 28. spvincent Lv 1 44 pts. 9,356
  9. Avatar for ZeroLeak7 29. ZeroLeak7 Lv 1 42 pts. 9,348
  10. Avatar for Bletchley Park 30. Bletchley Park Lv 1 41 pts. 9,304

Comments