Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for SKSbell 81. SKSbell Lv 1 5 pts. 8,883
  2. Avatar for benrh 82. benrh Lv 1 5 pts. 8,869
  3. Avatar for jamiexq 83. jamiexq Lv 1 5 pts. 8,869
  4. Avatar for alcor29 84. alcor29 Lv 1 4 pts. 8,836
  5. Avatar for Mr_Jolty 85. Mr_Jolty Lv 1 4 pts. 8,827
  6. Avatar for fpc 86. fpc Lv 1 4 pts. 8,808
  7. Avatar for dl2007 87. dl2007 Lv 1 4 pts. 8,784
  8. Avatar for carsonfb 88. carsonfb Lv 1 4 pts. 8,776
  9. Avatar for Reldas 89. Reldas Lv 1 3 pts. 8,760
  10. Avatar for Savas 90. Savas Lv 1 3 pts. 8,718

Comments