Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,465
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,171
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,140
  4. Avatar for xkcd 14. xkcd 1 pt. 8,924
  5. Avatar for Russian team 15. Russian team 1 pt. 8,766
  6. Avatar for :) 16. :) 1 pt. 8,723
  7. Avatar for GC Sommerlejr 2017 17. GC Sommerlejr 2017 1 pt. 8,346
  8. Avatar for Deleted group 18. Deleted group pts. 7,808
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 7,532
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,256
  1. Avatar for martinf 141. martinf Lv 1 1 pt. 7,783
  2. Avatar for etreit 142. etreit Lv 1 1 pt. 7,717
  3. Avatar for parthpatel09 143. parthpatel09 Lv 1 1 pt. 7,681
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 7,670
  5. Avatar for NotJim99 145. NotJim99 Lv 1 1 pt. 7,601
  6. Avatar for eromana 146. eromana Lv 1 1 pt. 7,556
  7. Avatar for BuzzDee 147. BuzzDee Lv 1 1 pt. 7,532
  8. Avatar for cnhrcolemam 148. cnhrcolemam Lv 1 1 pt. 7,491
  9. Avatar for ukpc5 149. ukpc5 Lv 1 1 pt. 7,373
  10. Avatar for fujioyama 150. fujioyama Lv 1 1 pt. 7,370

Comments