Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596
  1. Avatar for martinf 141. martinf Lv 1 1 pt. 7,783
  2. Avatar for etreit 142. etreit Lv 1 1 pt. 7,717
  3. Avatar for parthpatel09 143. parthpatel09 Lv 1 1 pt. 7,681
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 7,670
  5. Avatar for NotJim99 145. NotJim99 Lv 1 1 pt. 7,601
  6. Avatar for eromana 146. eromana Lv 1 1 pt. 7,556
  7. Avatar for BuzzDee 147. BuzzDee Lv 1 1 pt. 7,532
  8. Avatar for cnhrcolemam 148. cnhrcolemam Lv 1 1 pt. 7,491
  9. Avatar for ukpc5 149. ukpc5 Lv 1 1 pt. 7,373
  10. Avatar for fujioyama 150. fujioyama Lv 1 1 pt. 7,370

Comments