Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,465
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,171
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,140
  4. Avatar for xkcd 14. xkcd 1 pt. 8,924
  5. Avatar for Russian team 15. Russian team 1 pt. 8,766
  6. Avatar for :) 16. :) 1 pt. 8,723
  7. Avatar for GC Sommerlejr 2017 17. GC Sommerlejr 2017 1 pt. 8,346
  8. Avatar for Deleted group 18. Deleted group pts. 7,808
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 7,532
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,256
  1. Avatar for David M. 161. David M. Lv 1 1 pt. 7,156
  2. Avatar for shane_k 162. shane_k Lv 1 1 pt. 7,152
  3. Avatar for Jspirit 163. Jspirit Lv 1 1 pt. 7,146
  4. Avatar for dl2007 164. dl2007 Lv 1 1 pt. 7,040
  5. Avatar for dam_01 165. dam_01 Lv 1 1 pt. 7,030
  6. Avatar for Keresto 166. Keresto Lv 1 1 pt. 6,871
  7. Avatar for Germaican 167. Germaican Lv 1 1 pt. 6,718
  8. Avatar for Losiu 168. Losiu Lv 1 1 pt. 6,331
  9. Avatar for lazulite 169. lazulite Lv 1 1 pt. 6,231
  10. Avatar for 01010011111 170. 01010011111 Lv 1 1 pt. 5,588

Comments