Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596
  1. Avatar for David M. 161. David M. Lv 1 1 pt. 7,156
  2. Avatar for shane_k 162. shane_k Lv 1 1 pt. 7,152
  3. Avatar for Jspirit 163. Jspirit Lv 1 1 pt. 7,146
  4. Avatar for dl2007 164. dl2007 Lv 1 1 pt. 7,040
  5. Avatar for dam_01 165. dam_01 Lv 1 1 pt. 7,030
  6. Avatar for Keresto 166. Keresto Lv 1 1 pt. 6,871
  7. Avatar for Germaican 167. Germaican Lv 1 1 pt. 6,718
  8. Avatar for Losiu 168. Losiu Lv 1 1 pt. 6,331
  9. Avatar for lazulite 169. lazulite Lv 1 1 pt. 6,231
  10. Avatar for 01010011111 170. 01010011111 Lv 1 1 pt. 5,588

Comments