Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,465
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,171
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,140
  4. Avatar for xkcd 14. xkcd 1 pt. 8,924
  5. Avatar for Russian team 15. Russian team 1 pt. 8,766
  6. Avatar for :) 16. :) 1 pt. 8,723
  7. Avatar for GC Sommerlejr 2017 17. GC Sommerlejr 2017 1 pt. 8,346
  8. Avatar for Deleted group 18. Deleted group pts. 7,808
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 7,532
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,256

  1. Avatar for hansvandenhof 51. hansvandenhof Lv 1 19 pts. 9,619
  2. Avatar for pvc78 52. pvc78 Lv 1 18 pts. 9,616
  3. Avatar for joremen 53. joremen Lv 1 17 pts. 9,609
  4. Avatar for johngran 54. johngran Lv 1 17 pts. 9,601
  5. Avatar for O Seki To 55. O Seki To Lv 1 16 pts. 9,596
  6. Avatar for Glen B 56. Glen B Lv 1 15 pts. 9,583
  7. Avatar for MicElephant 57. MicElephant Lv 1 15 pts. 9,578
  8. Avatar for Anfinsen_slept_here 58. Anfinsen_slept_here Lv 1 14 pts. 9,559
  9. Avatar for cobaltteal 59. cobaltteal Lv 1 13 pts. 9,557
  10. Avatar for Vinara 60. Vinara Lv 1 13 pts. 9,554

Comments