1406: Revisiting Puzzle 134: Rice
Closed since over 8 years ago
Intermediate Overall PredictionSummary
- Created
- July 20, 2017
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH