Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,503
  1. Avatar for martinf 141. martinf Lv 1 1 pt. 7,783
  2. Avatar for etreit 142. etreit Lv 1 1 pt. 7,717
  3. Avatar for parthpatel09 143. parthpatel09 Lv 1 1 pt. 7,681
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 7,670
  5. Avatar for NotJim99 145. NotJim99 Lv 1 1 pt. 7,601
  6. Avatar for eromana 146. eromana Lv 1 1 pt. 7,556
  7. Avatar for BuzzDee 147. BuzzDee Lv 1 1 pt. 7,532
  8. Avatar for cnhrcolemam 148. cnhrcolemam Lv 1 1 pt. 7,491
  9. Avatar for ukpc5 149. ukpc5 Lv 1 1 pt. 7,373
  10. Avatar for fujioyama 150. fujioyama Lv 1 1 pt. 7,370

Comments