Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,503

  1. Avatar for caglar 31. caglar Lv 1 39 pts. 9,715
  2. Avatar for altejoh 32. altejoh Lv 1 38 pts. 9,715
  3. Avatar for grogar7 33. grogar7 Lv 1 36 pts. 9,714
  4. Avatar for georg137 34. georg137 Lv 1 35 pts. 9,713
  5. Avatar for jobo0502 35. jobo0502 Lv 1 34 pts. 9,711
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 33 pts. 9,703
  7. Avatar for Norrjane 37. Norrjane Lv 1 32 pts. 9,701
  8. Avatar for reefyrob 38. reefyrob Lv 1 31 pts. 9,700
  9. Avatar for Ikuso 39. Ikuso Lv 1 29 pts. 9,694
  10. Avatar for andrewxc 40. andrewxc Lv 1 28 pts. 9,692

Comments