1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Summary

• Created: July 20, 2017
• Expires: July 27, 2017 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

• 1. Contenders 100 pts. 9,997
• 2. Go Science 78 pts. 9,993
• 3. Beta Folders 60 pts. 9,964
• 4. Gargleblasters 45 pts. 9,947
• 5. Anthropic Dreams 33 pts. 9,936
• 6. Marvin's bunch 24 pts. 9,936
• 7. L'Alliance Francophone 17 pts. 9,804
• 8. Void Crushers 12 pts. 9,788
• 9. Kotocycle 8 pts. 9,694
• 10. HMT heritage 6 pts. 9,596

Top soloists

• 31. caglar 39 pts. 9,715
• 32. altejoh 38 pts. 9,715
• 33. grogar7 36 pts. 9,714
• 34. georg137 35 pts. 9,713
• 35. jobo0502 34 pts. 9,711
• 36. christioanchauvin 33 pts. 9,703
• 37. Norrjane 32 pts. 9,701
• 38. reefyrob 31 pts. 9,700
• 39. Ikuso 29 pts. 9,694
• 40. andrewxc 28 pts. 9,692