Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Contenders 100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596

  1. Avatar for caglar 31. caglar Lv 1 39 pts. 9,715
  2. Avatar for altejoh 32. altejoh Lv 1 38 pts. 9,715
  3. Avatar for grogar7 33. grogar7 Lv 1 36 pts. 9,714
  4. Avatar for georg137 34. georg137 Lv 1 35 pts. 9,713
  5. Avatar for jobo0502 35. jobo0502 Lv 1 34 pts. 9,711
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 33 pts. 9,703
  7. Avatar for Norrjane 37. Norrjane Lv 1 32 pts. 9,701
  8. Avatar for reefyrob 38. reefyrob Lv 1 31 pts. 9,700
  9. Avatar for Ikuso 39. Ikuso Lv 1 29 pts. 9,694
  10. Avatar for andrewxc 40. andrewxc Lv 1 28 pts. 9,692

Comments